PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G19800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 571aa    MW: 62893 Da    PI: 4.4932
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G19800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.32.7e-1137109348
                      SS-HHHHHHHHHHHHHTTTT............................-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg............................tWktIartmgkgRtlkqcksrwqkyl 48 
                      +W++eEd+ l   ++++G++                            +W+ Ia+ +   +t+ qc+ rw++yl
  LPERR07G19800.1  37 SWSAEEDDVLRAQIALHGTDkyefsllpvsidcfldlitvvytnfpfgSWTIIAAQFK-DKTARQCRRRWYNYL 109
                      6********************************************************9.**************7 PP

2Myb_DNA-binding41.53e-13115158146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g W+ eEd+ll +a k lG++ W+ Ia+ +  gRt++ +k+r+ +
  LPERR07G19800.1 115 KGGWSREEDLLLCEAQKVLGNK-WTEIAKVVS-GRTDNAVKNRFST 158
                      688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.6E-734111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-123797IPR009057Homeodomain-like
CDDcd001672.33E-737109No hitNo description
PROSITE profilePS500908.60637109IPR017877Myb-like domain
PfamPF139211.7E-1138125No hitNo description
SuperFamilySSF466895.47E-2589167IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-2398157IPR009057Homeodomain-like
PROSITE profilePS5129420.432110164IPR017930Myb domain
SMARTSM007173.5E-13114162IPR001005SANT/Myb domain
CDDcd001671.97E-9118159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MATGPDLSSP AAAAAAEAPL SSSAAATAVK KDRHIVSWSA EEDDVLRAQI ALHGTDKYEF  60
SLLPVSIDCF LDLITVVYTN FPFGSWTIIA AQFKDKTARQ CRRRWYNYLN SECKKGGWSR  120
EEDLLLCEAQ KVLGNKWTEI AKVVSGRTDN AVKNRFSTLC KRRAKDDELF KENGSLCSSV  180
NAKRALTQTE CVASDAAGSA PPIKQMRPCN SDFKENMTPN MRSLGEGKNT QDSRQPLAIV  240
YQNNQDNVNT MDTQNLAKTA AKQSCGEEQN CVKHEGNFLN KDDPKIATLL QRADLLCSLA  300
TKINTENTSM DEAWQQLQHH LDKKDDIDVS ESSTSEMASL LEDLDDLIVD PYENEEEDDQ  360
KLKDQTEQID VQNTENPSQT SMEVTSQMAP NNEMEDCPND KSTEDNNMES CPAKAGGGIP  420
TPENLTDAAI EDCLLHCVEY SSPVHIVIQA ITDAEIAASE NLSEVLEHNR LQCTKSAPFA  480
HTTTQAKTDA ETPASEKLSE VVKCSKPPCT EFTSPAHTVP TFLPYADDMP TPKFTASERN  540
FLLSVLELTS PGSRPDTSQQ PSCKRALLNS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-258616330107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00259DAPTransfer from AT2G02820Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0634260.0AK063426.1 Oryza sativa Japonica Group cDNA clone:001-115-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647542.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0D9X1Q20.0A0A0D9X1Q2_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g43420.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP89033847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.12e-72myb domain protein 88